DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33795 and LOC11176036

DIOPT Version :10

Sequence 1:NP_001027129.2 Gene:CG33795 / 3772625 FlyBaseID:FBgn0053795 Length:178 Species:Drosophila melanogaster
Sequence 2:XP_003436194.2 Gene:LOC11176036 / 11176036 VectorBaseID:AGAMI1_006310 Length:202 Species:Anopheles gambiae


Alignment Length:166 Identity:39/166 - (23%)
Similarity:69/166 - (41%) Gaps:24/166 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 TFLLTWRLSYSVTYKLTNVICESRNQSWVTINECRLKAVNRNR-TVFNFNATIHHPTNDVVIDYR 76
            ||.:...:|....||.|::      ..:.||       :.||: |:.|.:.||....|.|.:..:
Mosquito    39 TFKILKYISKETPYKRTHL------HYFKTI-------LRRNQPTLLNMSLTIPEVLNYVWVRIK 90

  Fly    77 FLKRENGYKPWLYKKNIDGCRFLR-KPYDMLTKMIYMVF-KPFSNINHTCPFYG----DILIRGM 135
            ...:.|.::|:|.....:.|.::| :|....|..||..| |....|...|| :|    ||:   .
Mosquito    91 LHYKFNTFQPFLIDMEQEACEYIRNRPIIPQTDYIYETFVKRLPAIAGPCP-HGNRTYDIV---W 151

  Fly   136 YLRTEIKAMPYPSGKYMLQINWSFYKKIQVVTNISY 171
            :|.........|:|:|.|.:.:.....:.:..:.:|
Mosquito   152 WLEERYTPRSIPAGEYRLDMKFVAIDNVTLFASETY 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33795NP_001027129.2 DUF1091 77..153 CDD:461928 21/81 (26%)
LOC11176036XP_003436194.2 None

Return to query results.
Submit another query.