DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His3:CG33848 and AT5G12910

DIOPT Version :9

Sequence 1:NP_001027358.1 Gene:His3:CG33848 / 3772619 FlyBaseID:FBgn0053848 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_196795.1 Gene:AT5G12910 / 831131 AraportID:AT5G12910 Length:131 Species:Arabidopsis thaliana


Alignment Length:135 Identity:94/135 - (69%)
Similarity:115/135 - (85%) Gaps:5/135 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRK 65
            |||:.|||||:||||||  ..|.:..:.|.|.   :|||:||:||||||||||:|||:|:|:|||
plant     1 MARSNQTARKATGGKAP--HFAMRVWQHSTPP---LKKPYRYKPGTVALREIRKYQKTTDLVIRK 60

  Fly    66 LPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARR 130
            |||||||:||||..|.|||||:.||.|||||:||::||:||||||||:||||.||||||||||:|
plant    61 LPFQRLVKEIAQSLKADLRFQTGAVSALQEAAEAFMVGMFEDTNLCAMHAKRSTIMPKDIQLAKR 125

  Fly   131 IRGER 135
            :||:|
plant   126 LRGDR 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His3:CG33848NP_001027358.1 PTZ00018 1..136 CDD:185400 94/135 (70%)
AT5G12910NP_196795.1 H4 1..130 CDD:419976 93/133 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1745
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54047
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11426
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.