DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His3:CG33848 and cenpa

DIOPT Version :10

Sequence 1:NP_001027358.1 Gene:His3:CG33848 / 3772619 FlyBaseID:FBgn0053848 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_001016585.1 Gene:cenpa / 549339 XenbaseID:XB-GENE-484234 Length:150 Species:Xenopus tropicalis


Alignment Length:149 Identity:36/149 - (24%)
Similarity:54/149 - (36%) Gaps:27/149 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   715 VVSIQGMNGDSRNMVDVKPVITEESNDKSKIWKLTEVSEPSQCRSLRLPENLRVAKISRLIFTNS 779
            |:.||...........|||...:.|:  .|:...|..:....|..|.|      |......||::
 Frog   525 VLPIQDGGKSQEEPSKVKPKFRKGSD--LKLLPCTSKAIMPYCLHLML------ACFKLRAFTDN 581

  Fly   780 GNAILALASNAIHLLWKWQRNERNATGKATASLPPQ---QWQPASGILMTNDVAETNPEEAVPCF 841
            .:. :||....:.|..:|.|.| |...||...:..|   |::.....:...|:.|.        |
 Frog   582 RDD-MALGHVIVLLQQEWPRGE-NLFLKAVNKICQQGNFQYENFFNYVTNIDMLEE--------F 636

  Fly   842 ALSKNDSYVMSASGGKISL 860
            |      |:.:..||||.|
 Frog   637 A------YLRTQEGGKIHL 649

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His3:CG33848NP_001027358.1 PTZ00018 1..136 CDD:185400
cenpaNP_001016585.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..56
HFD_H3 49..144 CDD:467036
H3-like 53..150
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.