DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His3:CG33848 and his-73

DIOPT Version :10

Sequence 1:NP_001027358.1 Gene:His3:CG33848 / 3772619 FlyBaseID:FBgn0053848 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_001366902.1 Gene:his-73 / 41657024 WormBaseID:WBGene00001947 Length:46 Species:Caenorhabditis elegans


Alignment Length:46 Identity:44/46 - (95%)
Similarity:45/46 - (97%) Gaps:0/46 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 MALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136
            ||||||:|||||||.|||||||||||||||||||||||||||||||
 Worm     1 MALQEAAEAYLVGLLEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 46

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His3:CG33848NP_001027358.1 PTZ00018 1..136 CDD:185400 42/44 (95%)
his-73NP_001366902.1 HFD_SF <1..46 CDD:480273 42/44 (95%)

Return to query results.
Submit another query.