DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His3:CG33848 and F20D6.9

DIOPT Version :9

Sequence 1:NP_001027358.1 Gene:His3:CG33848 / 3772619 FlyBaseID:FBgn0053848 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_505106.1 Gene:F20D6.9 / 184727 WormBaseID:WBGene00017638 Length:118 Species:Caenorhabditis elegans


Alignment Length:119 Identity:65/119 - (54%)
Similarity:81/119 - (68%) Gaps:4/119 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 APRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK 80
            |.:|.| :...|||  .|..|:. :.:..|||||||||:.|:||||||.:..|:|||:|:||||.
 Worm     2 AGKKNL-SGVCRKS--CTQPVRS-YPFHSGTVALREIRKQQQSTELLIPRSRFERLVKELAQDFV 62

  Fly    81 TDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGE 134
            |||.|:..|:.|||.|.|.|||.||...|||||..|||||...:::.|||||||
 Worm    63 TDLIFRKDAIDALQAAVEDYLVELFRLGNLCAIKCKRVTIEADNLKFARRIRGE 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His3:CG33848NP_001027358.1 PTZ00018 1..136 CDD:185400 65/119 (55%)
F20D6.9NP_505106.1 H4 <20..116 CDD:390056 55/96 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1745
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.