DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His3:CG33848 and his-70

DIOPT Version :10

Sequence 1:NP_001027358.1 Gene:His3:CG33848 / 3772619 FlyBaseID:FBgn0053848 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_497812.2 Gene:his-70 / 184006 WormBaseID:WBGene00001944 Length:134 Species:Caenorhabditis elegans


Alignment Length:130 Identity:30/130 - (23%)
Similarity:52/130 - (40%) Gaps:31/130 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   907 RVDEVKSKLKGHSKRITGL-AFSNVLNVLVSSGADAQLCV---WNTDGWEKQRSKVLPLPQGRPN 967
            ::|:..|:....|||..|| ..:..|.:|    .||::|:   .|||......|..:.....|.|
 Worm    10 KIDDSTSRQVTFSKRRKGLIKKAKELAIL----CDAEVCLIIFSNTDKLYDFASSSVKSTIERFN 70

  Fly   968 SAPSD--------TRVQFHQDQAHFL--VVHETQ-------------LAIYETTKLECMKQWAVR 1009
            :|..:        :.|:|.|.:|..|  .:|..|             |::.|...:|...:.::|
 Worm    71 TAKMEEQELMNPASEVKFWQREAETLRQELHSLQENYRQLTGVELNGLSVKELQNIESQLEMSLR 135

  Fly  1010  1009
             Worm   136  135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His3:CG33848NP_001027358.1 PTZ00018 1..136 CDD:185400
his-70NP_497812.2 HFD_SF 1..133 CDD:480273 29/126 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.