DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His3:CG33848 and his-45

DIOPT Version :9

Sequence 1:NP_001027358.1 Gene:His3:CG33848 / 3772619 FlyBaseID:FBgn0053848 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_502134.1 Gene:his-45 / 181821 WormBaseID:WBGene00001919 Length:136 Species:Caenorhabditis elegans


Alignment Length:136 Identity:132/136 - (97%)
Similarity:135/136 - (99%) Gaps:0/136 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRK 65
            ||||||||||||||||||||||||||||||||:|||||||||||||||||||||||||||||||:
 Worm     1 MARTKQTARKSTGGKAPRKQLATKAARKSAPASGGVKKPHRYRPGTVALREIRRYQKSTELLIRR 65

  Fly    66 LPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARR 130
            .||||||||||||||||||||||||||||||:|||||||||||||||||||||||||||||||||
 Worm    66 APFQRLVREIAQDFKTDLRFQSSAVMALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARR 130

  Fly   131 IRGERA 136
            ||||||
 Worm   131 IRGERA 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His3:CG33848NP_001027358.1 PTZ00018 1..136 CDD:185400 130/134 (97%)
his-45NP_502134.1 PTZ00018 1..136 CDD:185400 130/134 (97%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1745
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100119
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.800

Return to query results.
Submit another query.