DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2A:CG33838 and HTA6

DIOPT Version :10

Sequence 1:NP_001027341.1 Gene:His2A:CG33838 / 3772618 FlyBaseID:FBgn0053838 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_200795.1 Gene:HTA6 / 836109 AraportID:AT5G59870 Length:150 Species:Arabidopsis thaliana


Alignment Length:121 Identity:92/121 - (76%)
Similarity:103/121 - (85%) Gaps:0/121 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GRGKGGKVKGKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAG 67
            ||...|..|.|:.|:|.:||||||||||.|.|:||.||:|:|.|||||:|||:||||||||||||
plant    13 GRKPPGAPKTKSVSKSMKAGLQFPVGRITRFLKKGRYAQRLGGGAPVYMAAVLEYLAAEVLELAG 77

  Fly    68 NAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEKK 123
            ||||||||:|||||||.|||||||||.|||||||||.|||||||.:||||||:..|
plant    78 NAARDNKKSRIIPRHLLLAIRNDEELGKLLSGVTIAHGGVLPNINSVLLPKKSATK 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2A:CG33838NP_001027341.1 PTZ00017 16..124 CDD:185399 87/108 (81%)
HTA6NP_200795.1 PLN00157 13..138 CDD:177758 92/121 (76%)

Return to query results.
Submit another query.