DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33710 and CG31128

DIOPT Version :9

Sequence 1:NP_001027137.1 Gene:CG33710 / 3772611 FlyBaseID:FBgn0053710 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_733000.1 Gene:CG31128 / 318601 FlyBaseID:FBgn0051128 Length:166 Species:Drosophila melanogaster


Alignment Length:101 Identity:30/101 - (29%)
Similarity:47/101 - (46%) Gaps:17/101 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 PICGNCTNI-KNVHIS-TGFTCHFEDERQ-------VENKFGETDDKYAPCVPKDYVINGEVKNY 98
            |:|.||..| :...:| :|..|..:.:::       :..|....|:    |||..|.:.|.:.::
  Fly    35 PLCSNCNKIQRKCTVSHSGLFCKNKTDKEKILFSHSLAEKLYNLDE----CVPHKYNVTGPILDW 95

  Fly    99 CCFWSPTSGCSALIGRLLFDKSS---DYCDTCKGSC 131
            ||.|||..||..|.| :.:...|   |.|:.|..||
  Fly    96 CCLWSPKLGCQQLAG-IYYQNQSRWRDTCEICLHSC 130



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462403
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007611
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.