DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33757 and CG14518

DIOPT Version :9

Sequence 1:NP_001027398.1 Gene:CG33757 / 3772602 FlyBaseID:FBgn0053757 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_651653.2 Gene:CG14518 / 43421 FlyBaseID:FBgn0039621 Length:179 Species:Drosophila melanogaster


Alignment Length:169 Identity:52/169 - (30%)
Similarity:95/169 - (56%) Gaps:11/169 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLTPLQLEA---KFKSLHCTNYDRSYGEILLCKIKAINRYRNSISIQFRQLRTVNNVHMRLELFK 73
            |..|.|.:|   |..:..|..|::|:.|..||:::|::|.:..:::....|..|::|.::..|.|
  Fly    14 LQPPYQCDAVIFKMTNAVCETYNKSWVEFGLCRLRAVSRNKVCLNVDANLLHPVHDVIVKARLLK 78

  Fly    74 RANGWRPFLYNISFNLCDFLSKRNNVIVSLGYEYLKPYIPMTNYTCPFKKNHLIKCTDLEFDIEK 138
            ||||::|:||::||:.|.|:.:|||.::.:.:|..|.|..: |:|||:.....:|    .|.:..
  Fly    79 RANGYKPWLYSVSFDGCQFIRRRNNALIRIVWELFKEYSTI-NHTCPYVGLQQVK----NFYLRS 138

  Fly   139 FRVRFPIETGEYALQLSFIVQRKVTLTLNGSAEYYNYRE 177
            .::..||.||||.|.:.::..:|.....|   .|:.:.|
  Fly   139 EKLPTPIPTGEYLLMIDWVFNKKPQAATN---VYFTFVE 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33757NP_001027398.1 DUF1091 67..152 CDD:284008 31/84 (37%)
CG14518NP_651653.2 DM8 83..173 CDD:214778 29/97 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 43 1.000 Domainoid score I19524
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.