DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33757 and CG33919

DIOPT Version :9

Sequence 1:NP_001027398.1 Gene:CG33757 / 3772602 FlyBaseID:FBgn0053757 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027393.1 Gene:CG33919 / 3772720 FlyBaseID:FBgn0053919 Length:191 Species:Drosophila melanogaster


Alignment Length:166 Identity:46/166 - (27%)
Similarity:81/166 - (48%) Gaps:22/166 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LTPLQLEAKFKSLHCTNYDRSYGEILLCKIKAINRYRNSISIQFRQLRTVNNVHMRLELFKR--A 75
            ||..||..|.|.:.|. .:|:....:.|.:||||.....:::....:..::|..:|:::|.:  :
  Fly    17 LTNTQLVYKLKKIECL-VNRTRVSNVSCHVKAINWNLAVVNMDCFMIVPLHNPIIRMQVFTKDYS 80

  Fly    76 NGWRPFLYNISFNLCDFLSKRN----NVIVSLGYEYLKPYIPMTNYTCPFKKNHLIKCTDLEFDI 136
            |.::|||.::...:|:.:.:||    .||:   ::..|.|..: |::||| ..||| ..|...|.
  Fly    81 NQYKPFLVDVKIRICEVIERRNFIPYGVIM---WKLFKRYTNV-NHSCPF-SGHLI-ARDGFLDT 139

  Fly   137 EKFRVRFPIETGEYALQLSFIVQRKVTLTLNGSAEY 172
            ....   |...|.|  |:|.:    ||.|.:.|.:|
  Fly   140 SLLP---PFPQGFY--QVSLV----VTDTNSTSTDY 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33757NP_001027398.1 DUF1091 67..152 CDD:284008 25/90 (28%)
CG33919NP_001027393.1 DUF1091 70..152 CDD:284008 25/92 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 43 1.000 Domainoid score I19524
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.