DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33757 and CG33795

DIOPT Version :9

Sequence 1:NP_001027398.1 Gene:CG33757 / 3772602 FlyBaseID:FBgn0053757 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027129.2 Gene:CG33795 / 3772625 FlyBaseID:FBgn0053795 Length:178 Species:Drosophila melanogaster


Alignment Length:178 Identity:49/178 - (27%)
Similarity:93/178 - (52%) Gaps:12/178 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LAAVLFFVLVLLTPL-------QLEAKFKSLHCTNYDRSYGEILLCKIKAINRYRNSISIQFRQL 59
            ::.||..|::|:|.|       .:..|..::.|.:.::|:..|..|::||:||.|...:......
  Fly     1 MSNVLKIVVILVTFLLTWRLSYSVTYKLTNVICESRNQSWVTINECRLKAVNRNRTVFNFNATIH 65

  Fly    60 RTVNNVHMRLELFKRANGWRPFLYNISFNLCDFLSKRNNVIVSLGYEYLKPYIPMTNYTCPFKKN 124
            ...|:|.:.....||.||::|:||..:.:.|.||.|..:::..:.|...||:..: |:||||..:
  Fly    66 HPTNDVVIDYRFLKRENGYKPWLYKKNIDGCRFLRKPYDMLTKMIYMVFKPFSNI-NHTCPFYGD 129

  Fly   125 HLIKCTDLEFDIEKFRVRFPIETGEYALQLSFIVQRKVTLTLNGSAEY 172
            .||:...|..:|:    ..|..:|:|.||:::...:|:.:..|.|.::
  Fly   130 ILIRGMYLRTEIK----AMPYPSGKYMLQINWSFYKKIQVVTNISYDF 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33757NP_001027398.1 DUF1091 67..152 CDD:284008 26/84 (31%)
CG33795NP_001027129.2 DUF1091 77..153 CDD:284008 26/80 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 43 1.000 Domainoid score I19524
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.