DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33757 and CG33725

DIOPT Version :9

Sequence 1:NP_001027398.1 Gene:CG33757 / 3772602 FlyBaseID:FBgn0053757 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027125.1 Gene:CG33725 / 3772600 FlyBaseID:FBgn0053725 Length:181 Species:Drosophila melanogaster


Alignment Length:152 Identity:38/152 - (25%)
Similarity:82/152 - (53%) Gaps:5/152 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KFKSLHCTNYDRSYGEILLCKIKAINRYRNSISIQFRQLRTVNNVHMRLELFKRANGWRPFLYNI 85
            ||.:..|.:.::|:.....|::||::|.:..::.....|...||:.:.::|||:|||::|:|.::
  Fly    28 KFTNFACLSRNQSWFVFHNCRLKAVSREKVLLNFNGTVLHPANNIIVHVKLFKKANGFKPWLLDV 92

  Fly    86 SFNLCDFLSKRNNVIVSLGYEYLKPYIPMTNYTCPFKKNHLIKCTDLEFDIEKFRVRFPIETGEY 150
            ..:.|.|:....:..|.:.::..|.:..: |:|||:....::|    :|.:...:::.|..:|:|
  Fly    93 KLDACRFVRTNFHPFVRIIFDLFKDFSTI-NHTCPYVGLQVVK----DFYLRPEKLKLPFPSGDY 152

  Fly   151 ALQLSFIVQRKVTLTLNGSAEY 172
            .|.|.:|..::.....|.|..|
  Fly   153 LLSLIWIFDKRPQFDTNVSFVY 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33757NP_001027398.1 DUF1091 67..152 CDD:284008 21/84 (25%)
CG33725NP_001027125.1 DUF1091 74..154 CDD:284008 21/84 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 43 1.000 Domainoid score I19524
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.