DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33757 and CG33758

DIOPT Version :9

Sequence 1:NP_001027398.1 Gene:CG33757 / 3772602 FlyBaseID:FBgn0053757 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027397.1 Gene:CG33758 / 3772381 FlyBaseID:FBgn0053758 Length:178 Species:Drosophila melanogaster


Alignment Length:179 Identity:107/179 - (59%)
Similarity:141/179 - (78%) Gaps:3/179 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LAAVLFFVLVLLTPLQLEAKFKSLHCTNYDRSYGEILLCKIKAINRYRNSISIQFRQLRTVNNVH 66
            :.|:|||.|::||..::|||||||||..:|:.:||.||||:|||:|.|||||:|::..:.|:.:.
  Fly     1 MLALLFFTLLVLTSTEVEAKFKSLHCAAFDQDFGEFLLCKLKAISRLRNSISVQYKLKQPVSKIF 65

  Fly    67 MRLELFKRANGWRPFLYNISFNLCDFLSKRNNVIVSLGYEYLKPYIPMTNYTCPFK--KNHLIKC 129
            :|||.|||||||||||||.:.||||||::.||||:.:||.||:||: :.||:||||  :|.|::|
  Fly    66 IRLEFFKRANGWRPFLYNFTANLCDFLARNNNVIMGIGYAYLRPYL-VKNYSCPFKVIENELLEC 129

  Fly   130 TDLEFDIEKFRVRFPIETGEYALQLSFIVQRKVTLTLNGSAEYYNYREH 178
            .|.|.||...|.|||||||||||||:||.:.|..||:|||.||.||||:
  Fly   130 KDFELDINNLRNRFPIETGEYALQLTFIAKNKAALTINGSIEYNNYREY 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33757NP_001027398.1 DUF1091 67..152 CDD:284008 55/86 (64%)
CG33758NP_001027397.1 DUF1091 66..152 CDD:284008 55/86 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445331
Domainoid 1 1.000 43 1.000 Domainoid score I19524
eggNOG 1 0.900 - - E1_2FA8I
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.