DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33757 and CG33770

DIOPT Version :9

Sequence 1:NP_001027398.1 Gene:CG33757 / 3772602 FlyBaseID:FBgn0053757 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027144.2 Gene:CG33770 / 3772256 FlyBaseID:FBgn0053770 Length:185 Species:Drosophila melanogaster


Alignment Length:154 Identity:34/154 - (22%)
Similarity:59/154 - (38%) Gaps:45/154 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 EILLCKIKAINRYRNSISIQF-----RQLR--------TVNNVHMRLELFKR---ANGWR----- 79
            ||.||...|:...|...|::|     |..|        |:.|..:.|:::.|   ..|||     
  Fly    14 EIPLCLAIALFSIRAEGSVKFIAGESRFNRKYFENFTFTIRNDKIFLDMYLRKPLVRGWRARLDF 78

  Fly    80 ----------PFLYNISFNLCDFLSKRNNVIVSLGYEYLKPYIPMTNY--TCPFKKNHLIKCTDL 132
                      ..|::.|.::|:.:   |...::|..::.|..:...|:  .||...:|.. ..|.
  Fly    79 RTRVGNSKSFQSLFSTSIDVCNIV---NAAKINLFKKWYKNLLKYGNFLRQCPLNASHYY-LRDW 139

  Fly   133 EFD---IEKFRVRFPIETGEYALQ 153
            :|.   :..|     |.:|.|.|:
  Fly   140 QFGEGLVPPF-----ITSGSYRLE 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33757NP_001027398.1 DUF1091 67..152 CDD:284008 21/107 (20%)
CG33770NP_001027144.2 DM8 88..178 CDD:214778 17/80 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.