DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33757 and CG33920

DIOPT Version :9

Sequence 1:NP_001027398.1 Gene:CG33757 / 3772602 FlyBaseID:FBgn0053757 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027214.1 Gene:CG33920 / 3771875 FlyBaseID:FBgn0053920 Length:180 Species:Drosophila melanogaster


Alignment Length:174 Identity:44/174 - (25%)
Similarity:90/174 - (51%) Gaps:29/174 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LFFVLVLLTPLQLEAKFKSLHCTNYDRSYGEILLCKIKAINRYRNSISIQFRQLRT----VNNVH 66
            |..:.:.:..:..:.:|.::.|.:.|:.:.:...|.||::||....:||:.:..:|    :|.| 
  Fly    11 LLALSISIVEISSKFEFTNIMCNSLDKQFSDFEYCYIKSVNRSYKYVSIKAKLFKTPITKINGV- 74

  Fly    67 MRLELFKRANGWRPFLYNISFNLCDFLSK-RNNVIVSLGYEYLKPYIPMTNYTCPFKKNHLIKCT 130
             .|:.|...||:|||::||:.:.|.|::. ::|.|.|..|::::|:..| |:.||:         
  Fly    75 -ILKRFNGYNGYRPFMFNITLDACRFMNNTKSNPIASYLYDFIRPFTNM-NHNCPY--------- 128

  Fly   131 DLEFDIEKFRVRF---------PIETGEYALQ---LSFIVQRKV 162
            |.:..|||..:.|         |:..|:|..:   :::.::|.|
  Fly   129 DHDLVIEKLPIHFVNHQVTKVLPVPEGDYLYETNWMAYDIRRAV 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33757NP_001027398.1 DUF1091 67..152 CDD:284008 28/94 (30%)
CG33920NP_001027214.1 DUF1091 71..158 CDD:284008 29/98 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.060

Return to query results.
Submit another query.