DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33757 and CG33463

DIOPT Version :10

Sequence 1:NP_001027398.1 Gene:CG33757 / 3772602 FlyBaseID:FBgn0053757 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_995846.2 Gene:CG33463 / 2768844 FlyBaseID:FBgn0053463 Length:180 Species:Drosophila melanogaster


Alignment Length:168 Identity:48/168 - (28%)
Similarity:86/168 - (51%) Gaps:27/168 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LFFVLVLLTPLQLEAK------FKSLHCTNYDRSYGEILLCKIKAINRYRNSISIQFRQLR-TVN 63
            |..:|.|...:||.:|      ||:::|...|:.:.|...|.:|::||....||::.:.|: .|.
  Fly     5 LSLLLTLWLAMQLASKTTAMLEFKNINCEAVDKEFSEFEYCYLKSVNRTYKYISVKLKLLQLPVT 69

  Fly    64 NVHMRLELFKRANGWRPFLYNISFNLCDFL-SKRNNVIVSLGYEYLKPYIPMTNYTCPFKKNHLI 127
            |..:...||:|.||::||||||:.:.|..: :.:.:.:.|..::..|.:..| |::|||  ||  
  Fly    70 NAKVNGALFQRHNGYKPFLYNITVDCCKLVKNPKYSPVASYFFDTFKEFSNM-NHSCPF--NH-- 129

  Fly   128 KCTDLEFDIEKFRVR---------FPIETGEYALQLSF 156
                 :..::|...:         .|...|:|.|||::
  Fly   130 -----DIILDKLTAKSVYHRMTNILPFPEGDYMLQLNW 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33757NP_001027398.1 DUF1091 67..152 CDD:461928 25/94 (27%)
CG33463NP_995846.2 DUF1091 73..158 CDD:461928 25/94 (27%)

Return to query results.
Submit another query.