DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33725 and CG14518

DIOPT Version :9

Sequence 1:NP_001027125.1 Gene:CG33725 / 3772600 FlyBaseID:FBgn0053725 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_651653.2 Gene:CG14518 / 43421 FlyBaseID:FBgn0039621 Length:179 Species:Drosophila melanogaster


Alignment Length:156 Identity:87/156 - (55%)
Similarity:116/156 - (74%) Gaps:0/156 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 DAVVFKFTNFACLSRNQSWFVFHNCRLKAVSREKVLLNFNGTVLHPANNIIVHVKLFKKANGFKP 87
            |||:||.||..|.:.|:||..|..|||:||||.||.||.:..:|||.:::||..:|.|:|||:||
  Fly    21 DAVIFKMTNAVCETYNKSWVEFGLCRLRAVSRNKVCLNVDANLLHPVHDVIVKARLLKRANGYKP 85

  Fly    88 WLLDVKLDACRFVRTNFHPFVRIIFDLFKDFSTINHTCPYVGLQVVKDFYLRPEKLKLPFPSGDY 152
            ||..|..|.|:|:|...:..:||:::|||::|||||||||||||.||:||||.|||..|.|:|:|
  Fly    86 WLYSVSFDGCQFIRRRNNALIRIVWELFKEYSTINHTCPYVGLQQVKNFYLRSEKLPTPIPTGEY 150

  Fly   153 LLSLIWIFDKRPQFDTNVSFVYAEDL 178
            ||.:.|:|:|:||..|||.|.:.|||
  Fly   151 LLMIDWVFNKKPQAATNVYFTFVEDL 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33725NP_001027125.1 DUF1091 74..154 CDD:284008 46/79 (58%)
CG14518NP_651653.2 DM8 83..173 CDD:214778 51/89 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471914
Domainoid 1 1.000 43 1.000 Domainoid score I19524
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.990

Return to query results.
Submit another query.