DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33725 and CG14456

DIOPT Version :10

Sequence 1:NP_001027125.1 Gene:CG33725 / 3772600 FlyBaseID:FBgn0053725 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_001137998.1 Gene:CG14456 / 40481 FlyBaseID:FBgn0037176 Length:213 Species:Drosophila melanogaster


Alignment Length:121 Identity:31/121 - (25%)
Similarity:50/121 - (41%) Gaps:20/121 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 KAVSREKVL------LNFNGTVLHPANNIIVH--VKLFKKANGFKPWLLDVKLDACRFVR-TNFH 105
            |.||.:.|.      |||:..|....:::.:|  |::..|.:.:....|:..|:.||.:. .|..
  Fly    39 KFVSHKVVYDNSDPHLNFSMEVHQELHDVDIHVEVRITNKQDPYYNTNLNTTLNVCRILGFANKS 103

  Fly   106 PFVRIIFDLFKDFSTINHTCPYVGLQVVKDFYLRPE---KLKLPFPSGDYLLSLIW 158
            |..|.:....::|..|..|||     :.|..|....   |.||   .|.|.::..|
  Fly   104 PVGRFVHGFIREFGNIVETCP-----IAKGRYHWHRIHLKRKL---QGSYFINKFW 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33725NP_001027125.1 DUF1091 74..154 CDD:461928 22/85 (26%)
CG14456NP_001137998.1 DM8 82..189 CDD:214778 20/78 (26%)

Return to query results.
Submit another query.