DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33725 and CG13250

DIOPT Version :9

Sequence 1:NP_001027125.1 Gene:CG33725 / 3772600 FlyBaseID:FBgn0053725 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_649245.1 Gene:CG13250 / 40284 FlyBaseID:FBgn0037013 Length:192 Species:Drosophila melanogaster


Alignment Length:202 Identity:41/202 - (20%)
Similarity:64/202 - (31%) Gaps:67/202 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ILCVAVGIL--------------------VIDLNDAVVFKFTNFACLSRNQSWFVFHNCRLKAVS 53
            :.|:.|.||                    |||...|.:||                  |.:  |.
  Fly    13 LCCLVVPILWQPSLATRDFDIRWRDINCSVIDPTTAEIFK------------------CDI--VE 57

  Fly    54 REKVLLNFNGTVL---HPANNIIVHVKLFKKAN-GFKP--WLLDVKLDACRFVRTNFHPFVRII- 111
            ..|...||..|.|   .....:.|.:.:.:.|| ..:|  .|..:::|.|..:  .|....||: 
  Fly    58 MPKKQGNFLNTFLLLRRSVTKMWVELSVGQIANRKDRPVQQLFKIRVDGCHLI--EFRSKSRILN 120

  Fly   112 FDLFKDFSTINH--TCP------YVGLQVVKDFYLRPEKLKLPFPSGDYLLSLIWIFDKRPQFDT 168
            ..|.|...:.|:  .||      |...:    |.|.|:......|...:...|::      |...
  Fly   121 AVLHKLLQSGNYPDACPLLANVNYTSTR----FALNPDHFPAYMPDMKFNTKLVF------QLSR 175

  Fly   169 NVSFVYA 175
            |:..:.|
  Fly   176 NMGLIRA 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33725NP_001027125.1 DUF1091 74..154 CDD:284008 20/91 (22%)
CG13250NP_649245.1 DM8 95..181 CDD:214778 20/97 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472641
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.