DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33725 and CG12849

DIOPT Version :9

Sequence 1:NP_001027125.1 Gene:CG33725 / 3772600 FlyBaseID:FBgn0053725 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_611969.2 Gene:CG12849 / 37971 FlyBaseID:FBgn0035068 Length:172 Species:Drosophila melanogaster


Alignment Length:158 Identity:44/158 - (27%)
Similarity:71/158 - (44%) Gaps:21/158 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 FKFTNFACLSRNQSWFVFHNCRLKAVSREKVLLNFNGTVLH-PANNIIVHVKLFKKANGFKPWLL 90
            |:|.|..||.|::.:..|..|.||:|:|....|:....:.. |.:|.....:|..:.|....:..
  Fly    21 FEFNNVVCLVRDRMFMDFEYCYLKSVNRTYKYLSLKTKMFRLPVDNCETRFQLRMRENRRVLYNF 85

  Fly    91 DVKLDACRFVRTNFHPFVRIIFDLFKDFSTINHTCPYVGLQVVKDFYLRPEKLKLP--------- 146
            |.|:|:|:|:|...|.....::..|..:|.:|||||| ...:|.|        |||         
  Fly    86 DFKVDSCKFMRDRKHVIANWVYQTFGPYSNLNHTCPY-DHDIVLD--------KLPVQHLNKLVQ 141

  Fly   147 --FPSGDYLLSLIWIFDKRPQFDTNVSF 172
              .|.|.|:::..|:....|:.|..:.|
  Fly   142 SIIPDGRYMMNSTWMVAGIPRTDVILYF 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33725NP_001027125.1 DUF1091 74..154 CDD:284008 25/90 (28%)
CG12849NP_611969.2 DM8 80..172 CDD:214778 27/99 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472602
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
54.940

Return to query results.
Submit another query.