DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33725 and CG33923

DIOPT Version :9

Sequence 1:NP_001027125.1 Gene:CG33725 / 3772600 FlyBaseID:FBgn0053725 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_001027216.2 Gene:CG33923 / 3772652 FlyBaseID:FBgn0053923 Length:178 Species:Drosophila melanogaster


Alignment Length:189 Identity:59/189 - (31%)
Similarity:90/189 - (47%) Gaps:32/189 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LVTSILCVAVGILVIDLNDAVV-FKFTNFACLSRNQSWFVFHNCRLKAVSREKVLLNFNGTVLH- 67
            :.:.:..|.:.|.:...:.||. .:|.|..|::.:..:..|..|.||||||....|:....:|. 
  Fly     1 MFSPVRLVQLSIFLYSFHQAVCKVEFANIKCVTLDPEFADFDYCYLKAVSRTYKYLSLRVKLLET 65

  Fly    68 PANNIIVHVKLFKKANGFKPWLLDVKLDACRFVRT-NFHPFVRIIFDLFKDFSTINHTCPY---- 127
            |...|.::|.:.::.||:||:|.:|.:|||:|.:. ..:|..|.::..|||:|.|||:|||    
  Fly    66 PITKIKINVAILQRLNGYKPFLYNVTIDACKFYKNQKSNPIARYLYSFFKDYSNINHSCPYDHDI 130

  Fly   128 ---------VGLQVVKDFYLRPEKLKLPFPSGDYLLSLIWIFDKRPQFDTN--VSFVYA 175
                     |..||.|         .||.|.||||....|.     .:|.|  :..|||
  Fly   131 IVEKLPISHVNTQVTK---------VLPVPHGDYLFHSNWY-----AYDINRAIVDVYA 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33725NP_001027125.1 DUF1091 74..154 CDD:284008 33/93 (35%)
CG33923NP_001027216.2 DUF1091 72..157 CDD:284008 33/93 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472420
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.990

Return to query results.
Submit another query.