DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33725 and CG33795

DIOPT Version :9

Sequence 1:NP_001027125.1 Gene:CG33725 / 3772600 FlyBaseID:FBgn0053725 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_001027129.2 Gene:CG33795 / 3772625 FlyBaseID:FBgn0053795 Length:178 Species:Drosophila melanogaster


Alignment Length:178 Identity:71/178 - (39%)
Similarity:114/178 - (64%) Gaps:0/178 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LSKLVTSILCVAVGILVIDLNDAVVFKFTNFACLSRNQSWFVFHNCRLKAVSREKVLLNFNGTVL 66
            :|.::..::.:...:|...|:.:|.:|.||..|.||||||...:.||||||:|.:.:.|||.|:.
  Fly     1 MSNVLKIVVILVTFLLTWRLSYSVTYKLTNVICESRNQSWVTINECRLKAVNRNRTVFNFNATIH 65

  Fly    67 HPANNIIVHVKLFKKANGFKPWLLDVKLDACRFVRTNFHPFVRIIFDLFKDFSTINHTCPYVGLQ 131
            ||.|::::..:..|:.||:||||....:|.|||:|..:....::|:.:||.||.||||||:.|..
  Fly    66 HPTNDVVIDYRFLKRENGYKPWLYKKNIDGCRFLRKPYDMLTKMIYMVFKPFSNINHTCPFYGDI 130

  Fly   132 VVKDFYLRPEKLKLPFPSGDYLLSLIWIFDKRPQFDTNVSFVYAEDLI 179
            :::..|||.|...:|:|||.|:|.:.|.|.|:.|..||:|:.:.|:|:
  Fly   131 LIRGMYLRTEIKAMPYPSGKYMLQINWSFYKKIQVVTNISYDFIENLL 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33725NP_001027125.1 DUF1091 74..154 CDD:284008 33/79 (42%)
CG33795NP_001027129.2 DUF1091 77..153 CDD:284008 33/75 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471889
Domainoid 1 1.000 43 1.000 Domainoid score I19524
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.990

Return to query results.
Submit another query.