DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33725 and CG33769

DIOPT Version :9

Sequence 1:NP_001027125.1 Gene:CG33725 / 3772600 FlyBaseID:FBgn0053725 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_001027143.1 Gene:CG33769 / 3772499 FlyBaseID:FBgn0053769 Length:179 Species:Drosophila melanogaster


Alignment Length:166 Identity:32/166 - (19%)
Similarity:63/166 - (37%) Gaps:31/166 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KLVTSIL-CVAVGILVIDLNDAVVFKFTNFACLSRNQSWFVFHNCRLKAVSREKVLLNFNGTVLH 67
            |||..:| ||.|.:::......:.|:..:  | :.|:|  .|.|..::.:..:.::.....|.|.
  Fly     5 KLVPFVLGCVVVTVVIKQSGPRMTFRAGD--C-TYNRS--TFSNFSIQIIKTKVIMDMILVTTLR 64

  Fly    68 PANNIIVHVKLFKKANGFKPW--LLDVKLDACRFVRTNFHPFVRIIFDLFKDFSTINHTCPYVGL 130
              ..:..|:....:....||:  :....::.|..::.:.....|..|...........:||    
  Fly    65 --QGLKAHLSFEFRLTKAKPYQSVYQHDMNYCALIKGSQESIYRRWFTSMLKVGNFATSCP---- 123

  Fly   131 QVVKD--FYLR---------PEKLKLPFPSGDYLLS 155
              :::  :||.         |..|.|    |||.:|
  Fly   124 --IREGYYYLHGWTLDANNVPSFLYL----GDYRIS 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33725NP_001027125.1 DUF1091 74..154 CDD:284008 16/92 (17%)
CG33769NP_001027143.1 DM8 82..173 CDD:214778 15/82 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448042
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.