DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33725 and CG33912

DIOPT Version :9

Sequence 1:NP_001027125.1 Gene:CG33725 / 3772600 FlyBaseID:FBgn0053725 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_001027139.1 Gene:CG33912 / 3772438 FlyBaseID:FBgn0053912 Length:165 Species:Drosophila melanogaster


Alignment Length:139 Identity:37/139 - (26%)
Similarity:69/139 - (49%) Gaps:23/139 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 KFTNFACLSRNQSWFVFHNCRLKAVSREKVLLNFNGTVLH-PANNIIVHVKLFKKANGFKPWLLD 91
            :|.|..|.|.::.:.:...|.||:|:|....::....:|. |.:.:.:...|:|:..|:||:|.:
  Fly    27 EFANVQCESLDKDFALIEYCYLKSVNRSYKYVSIKVNLLKLPISKVKIRFGLYKRFTGYKPFLYN 91

  Fly    92 VKLDACRFVRT-NFHPFVR--IIFDLFKD---FSTINHTCPYVGLQVVKDFYLRPEKLKLPFPSG 150
            ..||||:|::: |.:|...  ||.|:..|   :.::|:....:                ||||.|
  Fly    92 ATLDACKFLKSPNSNPVALFFIIHDIVLDKMSYHSVNNKLTKI----------------LPFPEG 140

  Fly   151 DYLLSLIWI 159
            .|::.:.||
  Fly   141 HYMIEIHWI 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33725NP_001027125.1 DUF1091 74..154 CDD:284008 24/85 (28%)
CG33912NP_001027139.1 DUF1091 74..144 CDD:284008 24/85 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472355
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.