DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33725 and CG33777

DIOPT Version :9

Sequence 1:NP_001027125.1 Gene:CG33725 / 3772600 FlyBaseID:FBgn0053725 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_001027108.1 Gene:CG33777 / 3772311 FlyBaseID:FBgn0053777 Length:172 Species:Drosophila melanogaster


Alignment Length:149 Identity:53/149 - (35%)
Similarity:78/149 - (52%) Gaps:20/149 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VVFKFTNFACLSRNQSWFVFHNCRLKAVSREKVLLNFNGTVLH-PANNIIVHVKLFKKANGFKPW 88
            :|.||||..|.|.:..:....:|.||:|:|....|:....:|. |.:.|.|:...:|:.||:||.
  Fly    16 LVEKFTNIKCTSLDPEFAHVDHCYLKSVNRTYKYLSLRVNLLQKPVSRIKVNAATWKRYNGYKPS 80

  Fly    89 LLDVKLDACRFVRT-NFHPFVRIIFDLFKDFSTINHTCPYVGLQVVKDFYLRPEKLK-------- 144
            |.:..:|||:|::. ..:|....|:.||||:|.:|:|||:....:|       |||.        
  Fly    81 LYNFTVDACKFIKNPKSNPVAHYIYRLFKDYSNVNYTCPFNDDAIV-------EKLPISFVNNQV 138

  Fly   145 ---LPFPSGDYLLSLIWIF 160
               ||.||||||.|..|.|
  Fly   139 TSVLPVPSGDYLFSSHWYF 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33725NP_001027125.1 DUF1091 74..154 CDD:284008 33/91 (36%)
CG33777NP_001027108.1 DUF1091 72..151 CDD:284008 32/85 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472368
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.990

Return to query results.
Submit another query.