DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33725 and CG33764

DIOPT Version :9

Sequence 1:NP_001027125.1 Gene:CG33725 / 3772600 FlyBaseID:FBgn0053725 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_001027107.1 Gene:CG33764 / 3772289 FlyBaseID:FBgn0053764 Length:180 Species:Drosophila melanogaster


Alignment Length:171 Identity:52/171 - (30%)
Similarity:88/171 - (51%) Gaps:24/171 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LSKLVTSILCVAVGILVIDLNDAVVFKFTNFACLSRNQSWFVFHNCRLKAVSREKVLLNFNGTVL 66
            |:..|.|::.:...|..|    ..|.||||..|.|.::.:.:|.:..||:|:|....::....:|
  Fly     5 LNLFVASLILLTYYITEI----YSVVKFTNIQCQSLDRDFALFDSWFLKSVNRSYKYVSVKVKLL 65

  Fly    67 H-PANNIIVHVKLFKKANGFKPWLLDVKLDACRFVRT-NFHPFVRIIFDLFKDFSTINHTCPYVG 129
            . |.:.:.|...|:|:.||:.|:|.::..|||||:.: |.:|.....::.|||:|.|||:||:  
  Fly    66 KIPVSKVKVRFGLYKRVNGYMPFLYNMSFDACRFLTSPNPNPVALYFYNFFKDYSNINHSCPF-- 128

  Fly   130 LQVVKDFYLRPEKLK-----------LPFPSGDYLLSLIWI 159
                 |..:..:|:.           ||||.|.|::.:.||
  Fly   129 -----DHDIILDKMPYHSINNKVTKILPFPEGKYMIEMHWI 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33725NP_001027125.1 DUF1091 74..154 CDD:284008 31/91 (34%)
CG33764NP_001027107.1 DUF1091 74..159 CDD:284008 31/91 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472615
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.990

Return to query results.
Submit another query.