DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33725 and CG33688

DIOPT Version :9

Sequence 1:NP_001027125.1 Gene:CG33725 / 3772600 FlyBaseID:FBgn0053725 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_001027131.1 Gene:CG33688 / 3772065 FlyBaseID:FBgn0053688 Length:175 Species:Drosophila melanogaster


Alignment Length:161 Identity:51/161 - (31%)
Similarity:86/161 - (53%) Gaps:21/161 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ILCVAVGILVIDLNDAVVFK---FTNFACLSRNQSWFVFHNCRLKAVSRE----KVLLNFNGTVL 66
            ::.:.:|.|      |.||.   |||..|..|.:..:.|..|.:|||:|.    .:.:|.:..|:
  Fly     6 LILIILGYL------ATVFNHVTFTNLKCGIRGEKIYYFEKCFIKAVNRTHKYIDIYVNLHQQVV 64

  Fly    67 HPANNIIVHVKLFKKANGFKPWLLDVKLDACRFVRTNFHPFVRIIFDLFKDFSTINHTCPYVGLQ 131
               ||:.| :||.:..||:||:.:||.:|.|:|::......::.::|::|:.|.|||||||..:.
  Fly    65 ---NNVTV-IKLMRHNNGYKPFFVDVTIDVCKFLKDPRQSIIKKLYDIYKNNSNINHTCPYKDVV 125

  Fly   132 VVKDFY---LRPEKLK-LPFPSGDYLLSLIW 158
            :|...:   |..:.:| ||...|||.:...|
  Fly   126 IVHHLWTGNLESDFMKYLPLIDGDYAIYTEW 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33725NP_001027125.1 DUF1091 74..154 CDD:284008 30/83 (36%)
CG33688NP_001027131.1 DUF1091 72..152 CDD:284008 28/79 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.