DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33725 and CG33775

DIOPT Version :9

Sequence 1:NP_001027125.1 Gene:CG33725 / 3772600 FlyBaseID:FBgn0053725 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_001027410.1 Gene:CG33775 / 3772054 FlyBaseID:FBgn0053775 Length:182 Species:Drosophila melanogaster


Alignment Length:157 Identity:44/157 - (28%)
Similarity:76/157 - (48%) Gaps:24/157 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 KFTNFACLSRNQSWFVFHNCRLKAVSREKVLLNFNGTVLH------PANNIIVHVKLFKKANGFK 86
            :|.|..|.|.|:|:.||..|:|..:.|.:|     |..::      |..|..::..::::.|||:
  Fly    31 RFINMQCESYNESYAVFEKCKLNLLGRGRV-----GADMYLKLFQTPVENCWINWAMYRRYNGFQ 90

  Fly    87 PWLLDVKLDACRFV-RTNFHPFVRIIFDLFKDFSTINHTCPYVGLQVVKDFYLRPEKLK-LPFPS 149
            |:|.:|..|.|:.: ..|...|..::.:..|..|.:||:|||....:|.:.....:.|| ||.|.
  Fly    91 PFLYNVSTDLCQLLGNPNAISFQGLVINAIKKGSNLNHSCPYNHDIIVDNMEFSDDFLKTLPLPQ 155

  Fly   150 GDYLLSL------IW-----IFDKRPQ 165
            |.|.:.|      :|     :|.:|.:
  Fly   156 GVYKIQLRFATYKVWRVQVAVFIERTE 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33725NP_001027125.1 DUF1091 74..154 CDD:284008 25/81 (31%)
CG33775NP_001027410.1 DUF1091 78..160 CDD:284008 25/81 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472563
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
54.940

Return to query results.
Submit another query.