DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33725 and CG33927

DIOPT Version :9

Sequence 1:NP_001027125.1 Gene:CG33725 / 3772600 FlyBaseID:FBgn0053725 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_001027147.1 Gene:CG33927 / 3771851 FlyBaseID:FBgn0053927 Length:182 Species:Drosophila melanogaster


Alignment Length:176 Identity:69/176 - (39%)
Similarity:106/176 - (60%) Gaps:1/176 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LSKLVTSILCVAVGILVIDLNDAVVFKFTNFACLSRNQSWFVFHNCRLKAVSREKVLLNFNGTVL 66
            :|.::..:|...:.:.:..:| |..||||||.|.|.|::|...|.|||||:.|....|:||||||
  Fly     4 VSNVLYLVLFFRIALELGSIN-ASRFKFTNFVCDSVNETWLAVHQCRLKAIRRGTTTLSFNGTVL 67

  Fly    67 HPANNIIVHVKLFKKANGFKPWLLDVKLDACRFVRTNFHPFVRIIFDLFKDFSTINHTCPYVGLQ 131
            ...:...||.::||:||||||||.::..|.|||:|..:...|.|:|:|.|.||.:|.||||:|..
  Fly    68 KTISKFRVHGQIFKRANGFKPWLYNITFDGCRFLRKPYEAPVIIVFNLLKSFSNLNFTCPYMGPV 132

  Fly   132 VVKDFYLRPEKLKLPFPSGDYLLSLIWIFDKRPQFDTNVSFVYAED 177
            .:...::..|::.:|.|:|:||:.:.|...|.....|.:.|.:.|:
  Fly   133 HIMGLHIIGEQIPVPLPTGEYLIQIKWYISKTLFLSTGIKFAFEEN 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33725NP_001027125.1 DUF1091 74..154 CDD:284008 35/79 (44%)
CG33927NP_001027147.1 DUF1091 75..155 CDD:284008 35/79 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471888
Domainoid 1 1.000 43 1.000 Domainoid score I19524
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.990

Return to query results.
Submit another query.