DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33725 and CG33654

DIOPT Version :9

Sequence 1:NP_001027125.1 Gene:CG33725 / 3772600 FlyBaseID:FBgn0053725 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_001027165.1 Gene:CG33654 / 3771825 FlyBaseID:FBgn0053654 Length:168 Species:Drosophila melanogaster


Alignment Length:159 Identity:52/159 - (32%)
Similarity:82/159 - (51%) Gaps:23/159 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 CVAVGILVIDLN---DAVVFKFTNFACLSRNQSWFVFHNCRLKAVSREKVLLNFNGTVLHPANNI 72
            |..|.||||.|.   .:..|:|||..|.|.::|:..|..|.:::.:|....|.            
  Fly     7 CHIVVILVILLMAKWASSKFEFTNLQCTSFDKSFDDFEYCYIRSANRSYKYLT------------ 59

  Fly    73 IVHVKLFK--KANGFKPWLLDVKLDACRFVR-TNFHPFVRIIFDLFKDFSTINHTCPY----VGL 130
             :.|.|||  :.||::|::.::.||||||:: |:..|..:..::.|..:|.:||:||:    :..
  Fly    60 -LKVNLFKTPRFNGYRPFMFNITLDACRFLKNTDSKPIAKYFYEFFNSYSNLNHSCPFNHDLIVD 123

  Fly   131 QVVKDFYLRPEKLKLPFPSGDYLLSLIWI 159
            ::..||........||||.|||||...||
  Fly   124 KIPIDFVNHRVTNILPFPEGDYLLETHWI 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33725NP_001027125.1 DUF1091 74..154 CDD:284008 30/86 (35%)
CG33654NP_001027165.1 DUF1091 60..147 CDD:284008 30/86 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472394
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.990

Return to query results.
Submit another query.