DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33725 and CG33689

DIOPT Version :9

Sequence 1:NP_001027125.1 Gene:CG33725 / 3772600 FlyBaseID:FBgn0053725 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_001027132.2 Gene:CG33689 / 3771798 FlyBaseID:FBgn0053689 Length:178 Species:Drosophila melanogaster


Alignment Length:153 Identity:46/153 - (30%)
Similarity:81/153 - (52%) Gaps:5/153 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 FTNFACLSRNQSWFVFHNCRLKAVSR-EKVLLNFNGTVLHPANNIIVHVKLFKKANGFKPWLLDV 92
            |||..|.|::.::.:|..|.:|||:| .|.:..:......|.:||.:..:|.:..:|:||:.:|.
  Fly    23 FTNIKCGSKDPTFAIFKKCFIKAVNRTHKYVDVYVNLYKLPIDNITISFRLMRHDHGYKPFFIDY 87

  Fly    93 KLDACRFVRTNFHPFVRIIFDLFKDFSTINHTCPYVGLQVVKDFY---LRPEKLK-LPFPSGDYL 153
            ..|.|:|:|...||.:::.:.:::..|.|||||||....:|...:   :..:.|| :|..:|||.
  Fly    88 TFDGCKFLRNQKHPIIKLFYKIYQGSSNINHTCPYDHDIIVDHLWTGNIESDFLKYIPMINGDYA 152

  Fly   154 LSLIWIFDKRPQFDTNVSFVYAE 176
            :...|..|...:...|:.|...|
  Fly   153 VYSNWSTDNIMRAYLNLYFRVTE 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33725NP_001027125.1 DUF1091 74..154 CDD:284008 26/83 (31%)
CG33689NP_001027132.2 DUF1091 73..153 CDD:284008 26/79 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
55.060

Return to query results.
Submit another query.