DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33725 and CG14492

DIOPT Version :9

Sequence 1:NP_001027125.1 Gene:CG33725 / 3772600 FlyBaseID:FBgn0053725 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_611275.2 Gene:CG14492 / 37045 FlyBaseID:FBgn0034283 Length:199 Species:Drosophila melanogaster


Alignment Length:138 Identity:29/138 - (21%)
Similarity:56/138 - (40%) Gaps:41/138 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 DLNDAVVFKFT-NFACLSRNQSW---FVF------HNCRLKAV-SREKVLLNFNGTVLHPANNII 73
            |::.:|:.:|| ..:..::.::|   ||.      |:..:|.| .|.:.|.:|            
  Fly    45 DISSSVLKEFTCGISKSTKRRTWHMEFVLEQPVAEHDFFIKIVLPRRRPLPDF------------ 97

  Fly    74 VHVKLFKKANGFKPWLLDVKLDACRFV-RTNFHPFVRIIFDLFKDFSTINHTCPYVGLQVVKDFY 137
                          .||:|..|.|:.: ..|..|.:|:..::.:.||.....||:   :....:|
  Fly    98 --------------VLLNVTTDGCQLLANRNQVPLMRLGRNIMERFSNFPKQCPF---KPNFTYY 145

  Fly   138 LRPEKLKL 145
            :|..:|.|
  Fly   146 IRGFRLDL 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33725NP_001027125.1 DUF1091 74..154 CDD:284008 16/73 (22%)
CG14492NP_611275.2 DM8 95..186 CDD:214778 17/88 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.