DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33725 and CG33454

DIOPT Version :9

Sequence 1:NP_001027125.1 Gene:CG33725 / 3772600 FlyBaseID:FBgn0053725 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_995887.1 Gene:CG33454 / 2768850 FlyBaseID:FBgn0053454 Length:173 Species:Drosophila melanogaster


Alignment Length:178 Identity:78/178 - (43%)
Similarity:116/178 - (65%) Gaps:5/178 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLSKLVTSILCVAVGILVIDLNDAVVFKFTNFACLSRNQSWFVFHNCRLKAVSREKVLLNFNGTV 65
            ||:.::  ||.|.|.::.:..:|:.:.|.||..|.|.::|..|||.|||||.||.|..|:.|.|.
  Fly     1 MLANVI--ILGVFVAVVFLVYSDSAMVKMTNVVCESYDKSLTVFHYCRLKAYSRTKTSLHINATF 63

  Fly    66 LHPANNIIVHVKLFKKANGFKPWLLDVKLDACRFVRTNFHPFVRIIFDLFKDFSTINHTCPYVGL 130
            |||.|:|.|..::.|:|||:||:|.|:.:|||:|:|...:|.::|::::.||.|.|||:||| |.
  Fly    64 LHPINSISVRFQMLKRANGYKPFLFDITVDACQFLRKPNNPVIKIVYNMIKDASNINHSCPY-GT 127

  Fly   131 QVVKDFYLRPEKLKLPFPSGDYLLSLIWIFDKRPQFDTNVSFVYAEDL 178
            .|:.||:  ...|.|||||||||..|.::.:.:.:|..||:....|||
  Fly   128 VVLNDFH--RISLPLPFPSGDYLSRLDFLINGKTKFYVNVNMHVPEDL 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33725NP_001027125.1 DUF1091 74..154 CDD:284008 38/79 (48%)
CG33454NP_995887.1 DUF1091 72..148 CDD:284008 37/78 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471901
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.990

Return to query results.
Submit another query.