DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33725 and CG33467

DIOPT Version :9

Sequence 1:NP_001027125.1 Gene:CG33725 / 3772600 FlyBaseID:FBgn0053725 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_001286440.1 Gene:CG33467 / 2768834 FlyBaseID:FBgn0053467 Length:188 Species:Drosophila melanogaster


Alignment Length:152 Identity:44/152 - (28%)
Similarity:79/152 - (51%) Gaps:10/152 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VVFKFTNFACLSRNQSWFVFHNCRLKAVSREKVLLNFNGTVLHPANNIIVHVKLFKK--ANGFKP 87
            :|:|||...| ..||:.....:|.:|.::....|:|.:..:::|..|..:.|::|.|  :|.:||
  Fly    22 LVYKFTKVEC-QGNQARVKNVSCNVKPINWNTALVNLDCYLIYPLINPTIRVQVFMKDYSNQYKP 85

  Fly    88 WLLDVKLDACRFV-RTNFHPFVRIIFDLFKDFSTINHTCPYVGLQVVKDFYLRPEKLKLPFPSGD 151
            :|:|.....|..| |.||.|:..::::||:.|:.:. :|...|....::.||....:. |||.|.
  Fly    86 FLIDATFKLCDVVERKNFLPYAVMVWELFQRFTNVK-SCHISGQLSARNGYLNSSYVP-PFPHGQ 148

  Fly   152 YLLSLIWIFDKRPQFDTNVSFV 173
            |.:|:::    .....||..||
  Fly   149 YQISVMF----SDSNSTNREFV 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33725NP_001027125.1 DUF1091 74..154 CDD:284008 26/82 (32%)
CG33467NP_001286440.1 DUF1091 70..151 CDD:284008 26/82 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471928
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.