DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59f and yghU

DIOPT Version :10

Sequence 1:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_417463.4 Gene:yghU / 947472 ECOCYCID:G7553 Length:288 Species:Escherichia coli


Alignment Length:103 Identity:22/103 - (21%)
Similarity:33/103 - (32%) Gaps:37/103 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ERLSSFNPQYAERYKELYRTLFWLLLISVLA--------NTAPITILPGCPNRF----------- 62
            |:...|.||...:..|....||||...:...        :.||:.| ....|||           
E. coli   127 EKFGYFLPQDLAKRTETMNWLFWLQGAAPFLGGGFGHFYHYAPVKI-EYAINRFTMEAKRLLDVL 190

  Fly    63 --------------YRLVHLS-WMILWYGLFVLGSYWE 85
                          |.:..:: |.  |:|..|||..::
E. coli   191 DKQLAQHKFVAGDEYTIADMAIWP--WFGNVVLGGVYD 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59fNP_788432.1 7tm_7 61..388 CDD:473258 9/51 (18%)
yghUNP_417463.4 PRK11752 1..264 CDD:183298 22/103 (21%)

Return to query results.
Submit another query.