DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59f and CAM1

DIOPT Version :10

Sequence 1:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_015277.1 Gene:CAM1 / 856059 SGDID:S000005969 Length:415 Species:Saccharomyces cerevisiae


Alignment Length:113 Identity:20/113 - (17%)
Similarity:41/113 - (36%) Gaps:35/113 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 KLMTNIVTSDLNRAYTIDCNRTKRFIRLQLFLVGIFACLAI------------------------ 168
            |:.|.::.:|      .|.|...:.||.| .|.....|:.|                        
Yeast    78 KMKTQLLGAD------DDLNAQAQIIRWQ-SLANSDLCIQIANTIVPLKGGAPYNKKSVDSAMDA 135

  Fly   169 ---FFNIWTHKFVVYRSILSINSYVMPNIISSISFAQYYLLLQGIAWR 213
               ..:|:.::...| :.|:..:..:.:::::..|.:|:..|.|..||
Yeast   136 VDKIVDIFENRLKNY-TYLATENISLADLVAASIFTRYFESLFGTEWR 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59fNP_788432.1 7tm_7 61..388 CDD:473258 20/113 (18%)
CAM1NP_015277.1 GST_N_EF1Bgamma 4..73 CDD:239342
GST_C_EF1Bgamma_like 92..214 CDD:198290 15/93 (16%)
EF1G 255..359 CDD:459888
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.