DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59f and CAM1

DIOPT Version :9

Sequence 1:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_015277.1 Gene:CAM1 / 856059 SGDID:S000005969 Length:415 Species:Saccharomyces cerevisiae


Alignment Length:113 Identity:20/113 - (17%)
Similarity:41/113 - (36%) Gaps:35/113 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 KLMTNIVTSDLNRAYTIDCNRTKRFIRLQLFLVGIFACLAI------------------------ 168
            |:.|.::.:|      .|.|...:.||.| .|.....|:.|                        
Yeast    78 KMKTQLLGAD------DDLNAQAQIIRWQ-SLANSDLCIQIANTIVPLKGGAPYNKKSVDSAMDA 135

  Fly   169 ---FFNIWTHKFVVYRSILSINSYVMPNIISSISFAQYYLLLQGIAWR 213
               ..:|:.::...| :.|:..:..:.:::::..|.:|:..|.|..||
Yeast   136 VDKIVDIFENRLKNY-TYLATENISLADLVAASIFTRYFESLFGTEWR 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59fNP_788432.1 7tm_7 61..388 CDD:303125 20/113 (18%)
CAM1NP_015277.1 GST_N_EF1Bgamma 4..73 CDD:239342
GST_C_EF1Bgamma_like 92..214 CDD:198290 15/93 (16%)
EF1G 255..359 CDD:395522
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.