DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59f and URE2

DIOPT Version :9

Sequence 1:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_014170.1 Gene:URE2 / 855492 SGDID:S000005173 Length:354 Species:Saccharomyces cerevisiae


Alignment Length:217 Identity:41/217 - (18%)
Similarity:73/217 - (33%) Gaps:75/217 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 QRRLTEGLERELTHLHSPRISE-VQKIRMHHANLIDFTKAVNRTFQYSILLLFVG-----CFLNF 272
            |.|..:....:::|:...||:: .|:..:....|.....|.| .|:.:|:|..:|     .||:|
Yeast    83 QHRQQQQAFSDMSHVEYSRITKFFQEQPLEGYTLFSHRSAPN-GFKVAIVLSELGFHYNTIFLDF 146

  Fly   273 NL----------------VLFLVYQGIENPSMAD------------FTKWVCMLLW--------- 300
            ||                |..|:..|::|.|:.:            :.:....|||         
Yeast   147 NLGEHRAPEFVSVNPNARVPALIDHGMDNLSIWESGAILLHLVNKYYKETGNPLLWSDDLADQSQ 211

  Fly   301 --------LAMHVGKVCSILHFNQSIQNEHSTCLTLLSRVSYARKDIQDTITHFIIQMRTNVRQH 357
                    .:.|...:...|||                |..:::| |...:..:..::|.     
Yeast   212 INAWLFFQTSGHAPMIGQALHF----------------RYFHSQK-IASAVERYTDEVRR----- 254

  Fly   358 VVCGVINLDLKFLTTLLVASAD 379
             |.||:.:.|......||...|
Yeast   255 -VYGVVEMALAERREALVMELD 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59fNP_788432.1 7tm_7 61..388 CDD:303125 41/217 (19%)
URE2NP_014170.1 GST_N_Ure2p_like 114..194 CDD:239346 17/80 (21%)
GST_C_Ure2p 208..350 CDD:198326 15/91 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.