DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59f and GTT1

DIOPT Version :9

Sequence 1:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_012304.1 Gene:GTT1 / 854856 SGDID:S000001477 Length:234 Species:Saccharomyces cerevisiae


Alignment Length:204 Identity:41/204 - (20%)
Similarity:66/204 - (32%) Gaps:71/204 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 ELTHLH----SPRISEVQ-------KIRMHHANLIDFTKAVNRTFQYSILLLFVGCFL--NFNLV 275
            ||..:|    || :.|||       ||......:..:   |.:.|.:|.:|:.....:  ..|..
Yeast    46 ELKKIHPLGRSP-LLEVQDRETGKKKILAESGFIFQY---VLQHFDHSHVLMSEDADIADQINYY 106

  Fly   276 LFLVYQGIENPSMADFTKWVCMLLWLAMHVGKVCSILHFNQSIQNEHSTCLTLLSRV-------- 332
            ||.|...::.|.|.:|                                    :||:|        
Yeast   107 LFYVEGSLQPPLMIEF------------------------------------ILSKVKDSGMPFP 135

  Fly   333 -SYARKDIQDTITHFIIQMRTNVRQHVVCGVINLDLKFLTTLLVASADFFI-FLLQY-------- 387
             ||..:.:.|.|:..........:...|.|.|:.:..:|....::.||..: |.||.        
Yeast   136 ISYLARKVADKISQAYSSGEVKNQFDFVEGEISKNNGYLVDGKLSGADILMSFPLQMAFERKFAA 200

  Fly   388 DVTYEALSK 396
            ...|.|:||
Yeast   201 PEDYPAISK 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59fNP_788432.1 7tm_7 61..388 CDD:303125 37/194 (19%)
GTT1NP_012304.1 GST_N_GTT1_like 6..87 CDD:239344 11/44 (25%)
GST_C_GTT1_like 93..218 CDD:198298 27/153 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.