DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59f and GSTF6

DIOPT Version :10

Sequence 1:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_171792.1 Gene:GSTF6 / 839515 AraportID:AT1G02930 Length:208 Species:Arabidopsis thaliana


Alignment Length:68 Identity:14/68 - (20%)
Similarity:29/68 - (42%) Gaps:4/68 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 LSINSYVMPNIISSISFAQYYLLLQGIAWRQRRLTEGLERELT---HLHSPRISEVQKIRMHHAN 245
            :.|.|:....:.|.:.:.|....|.|:. ..:.:.|..|.:|.   .::..|:.|.:.:...|..
plant   100 IEIESHEFDPVGSKLVWEQVLKPLYGMT-TDKTVVEEEEAKLAKVLDVYEHRLGESKYLASDHFT 163

  Fly   246 LID 248
            |:|
plant   164 LVD 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59fNP_788432.1 7tm_7 61..388 CDD:473258 14/68 (21%)
GSTF6NP_171792.1 GST_N_Phi 4..77 CDD:239351
GST_C_Phi 91..208 CDD:198296 14/68 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.