DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59f and GSTF4

DIOPT Version :10

Sequence 1:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001320441.1 Gene:GSTF4 / 838240 AraportID:AT1G02950 Length:255 Species:Arabidopsis thaliana


Alignment Length:99 Identity:21/99 - (21%)
Similarity:38/99 - (38%) Gaps:20/99 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 ACLAIFFNIWTHKFVVYRSILSINSYVMPNIISSISFAQYYLLLQGIAWRQRRLTEG---LEREL 225
            |.|.::..|..|:|....|.|:....:.|              :.|:...|..:.|.   ||:.|
plant   129 ATLTMWMEIEAHQFDPPASKLTWEQVIKP--------------IYGLETDQTIVKENEAILEKVL 179

  Fly   226 THLHSPRISEVQKIRMHHANLIDFTKAVNRTFQY 259
             :::..|:.|.:.:..:...|:|.....|  .||
plant   180 -NIYEKRLEESRFLACNSFTLVDLHHLPN--IQY 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59fNP_788432.1 7tm_7 61..388 CDD:473258 21/99 (21%)
GSTF4NP_001320441.1 GST_N_Phi 38..109 CDD:239351
GST_C_Phi 126..243 CDD:198296 21/99 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.