DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59f and AT1G09640

DIOPT Version :10

Sequence 1:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_563848.1 Gene:AT1G09640 / 837491 AraportID:AT1G09640 Length:414 Species:Arabidopsis thaliana


Alignment Length:107 Identity:27/107 - (25%)
Similarity:33/107 - (30%) Gaps:35/107 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   280 YQGIENPSMADFTK---WVCMLLWLAMHVG----------KVCSILHFNQSIQNEHSTCLTLLSR 331
            |..||  ...||:.   :..:|.|....:|          ...|.|.......|.|.|..|.|..
plant    91 YAQIE--QWIDFSSLEIYASILRWFGPRMGFMPYSAPAEEGAISTLKRALDALNTHLTSNTYLVG 153

  Fly   332 VSYARKDIQDTITHFIIQMRTNVRQHVVCGVINLDLKFLTTL 373
            .|....||   ||              ||   ||:|.|.|.:
plant   154 HSITLADI---IT--------------VC---NLNLGFATVM 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59fNP_788432.1 7tm_7 61..388 CDD:473258 27/107 (25%)
AT1G09640NP_563848.1 GST_N_EF1Bgamma 3..77 CDD:239342
GST_C_EF1Bgamma_like 90..210 CDD:198290 27/107 (25%)
EF1G 255..361 CDD:459888
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.