DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59f and GSTT2

DIOPT Version :10

Sequence 1:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_198940.3 Gene:GSTT2 / 834125 AraportID:AT5G41240 Length:591 Species:Arabidopsis thaliana


Alignment Length:41 Identity:10/41 - (24%)
Similarity:19/41 - (46%) Gaps:5/41 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 YKELYRTLFWLLLISVLANTAPITILP-----GCPNRFYRL 65
            |.|.....||..:.:.::|:|.:..||     .|..|:.::
plant   297 YDEQQAHTFWKRIGAHVSNSASLANLPKREWNHCRQRWRKI 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59fNP_788432.1 7tm_7 61..388 CDD:473258 1/5 (20%)
GSTT2NP_198940.3 GST_N_Theta 3..78 CDD:239348
GST_C_Theta 92..221 CDD:198292
NAM-associated 380..488 CDD:464129
DUF5401 <438..588 CDD:375164
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.