DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59f and GSTT3

DIOPT Version :10

Sequence 1:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_198938.1 Gene:GSTT3 / 834124 AraportID:AT5G41220 Length:590 Species:Arabidopsis thaliana


Alignment Length:64 Identity:19/64 - (29%)
Similarity:25/64 - (39%) Gaps:14/64 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   265 FVGCF---LNFNL-------VLFLVYQGIENPSMADFTKWVCMLLWLAM-HVGKVCSILHFNQS 317
            ||||:   ||...       |..:.||...|...::||   ....|..: |..|.||:..|..|
plant   342 FVGCYDQALNQRSSGQSEDDVFQVAYQVYTNNYKSNFT---LEHAWRELRHSKKWCSLYPFENS 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59fNP_788432.1 7tm_7 61..388 CDD:473258 19/64 (30%)
GSTT3NP_198938.1 GST_N_Theta 3..78 CDD:239348
GST_C_Theta 92..221 CDD:198292
NAM-associated 378..487 CDD:464129 9/28 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.