DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59f and GSTF12

DIOPT Version :10

Sequence 1:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_197224.1 Gene:GSTF12 / 831586 AraportID:AT5G17220 Length:214 Species:Arabidopsis thaliana


Alignment Length:60 Identity:16/60 - (26%)
Similarity:24/60 - (40%) Gaps:20/60 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   284 ENPSMADFTKWVCMLLWLAMHVGKVCSILHFNQSIQNEHSTCLTLLSRVSYAR--KDIQD 341
            |..:|||.|....|        |.:.||...||.::          :|.|:.|  ::|.|
plant   160 EEFTMADLTHMPAM--------GYLMSITDINQMVK----------ARGSFNRWWEEISD 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59fNP_788432.1 7tm_7 61..388 CDD:473258 16/60 (27%)
GSTF12NP_197224.1 PLN02473 1..214 CDD:166114 16/60 (27%)

Return to query results.
Submit another query.