DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59f and GSTF10

DIOPT Version :10

Sequence 1:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_180644.1 Gene:GSTF10 / 817637 AraportID:AT2G30870 Length:215 Species:Arabidopsis thaliana


Alignment Length:30 Identity:9/30 - (30%)
Similarity:15/30 - (50%) Gaps:5/30 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 VYRSILSINSYVMPNIIS-----SISFAQY 203
            ||.:.||.|.|:..:.:|     .:.|.:|
plant   145 VYEAQLSKNEYLAGDFVSLADLAHLPFTEY 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59fNP_788432.1 7tm_7 61..388 CDD:473258 9/30 (30%)
GSTF10NP_180644.1 PLN02395 1..215 CDD:166036 9/30 (30%)

Return to query results.
Submit another query.