DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59f and GSTF9

DIOPT Version :10

Sequence 1:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_180643.1 Gene:GSTF9 / 817636 AraportID:AT2G30860 Length:215 Species:Arabidopsis thaliana


Alignment Length:39 Identity:10/39 - (25%)
Similarity:16/39 - (41%) Gaps:4/39 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LSSFNPQYAERYKELYRTLFWLLLISVLANTAPITILPG 57
            |..:.|.:|..    .|.|..|:...|...|.|:.::.|
plant     3 LKVYGPHFASP----KRALVTLIEKGVAFETIPVDLMKG 37

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59fNP_788432.1 7tm_7 61..388 CDD:473258
GSTF9NP_180643.1 PLN02395 1..215 CDD:166036 10/39 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.