DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59f and GSTF3

DIOPT Version :10

Sequence 1:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_178394.1 Gene:GSTF3 / 814822 AraportID:AT2G02930 Length:212 Species:Arabidopsis thaliana


Alignment Length:74 Identity:14/74 - (18%)
Similarity:29/74 - (39%) Gaps:1/74 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 SINSYVMPNIISSISFAQYYLLLQGIAWRQ-RRLTEGLERELTHLHSPRISEVQKIRMHHANLID 248
            :|..|.:.:|...:...|:..:...:||.| .:...||..:...:........:.:.::.|.|.:
plant    93 NIAQYAIMSIGIQVEAHQFDPVASKLAWEQVFKFNYGLNTDQAVVAEEEAKLAKVLDVYEARLKE 157

  Fly   249 FTKAVNRTF 257
            |......||
plant   158 FKYLAGETF 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59fNP_788432.1 7tm_7 61..388 CDD:473258 14/74 (19%)
GSTF3NP_178394.1 GST_N_Phi 4..78 CDD:239351
GST_C_Phi 96..212 CDD:198296 13/71 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.