DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59f and GSTZ1

DIOPT Version :10

Sequence 1:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_973400.1 Gene:GSTZ1 / 814770 AraportID:AT2G02390 Length:228 Species:Arabidopsis thaliana


Alignment Length:56 Identity:13/56 - (23%)
Similarity:24/56 - (42%) Gaps:13/56 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 SINSYVMPNIISSISFAQYYLLLQGI----------AWRQRRLTEG---LERELTH 227
            ::|...|..::|.|...|...:::.|          ||....:|:|   ||:.|.:
plant   105 AVNYQAMSIVLSGIQPHQNLAVIRYIEEKINVEEKTAWVNNAITKGFTALEKLLVN 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59fNP_788432.1 7tm_7 61..388 CDD:473258 13/56 (23%)
GSTZ1NP_973400.1 maiA 10..224 CDD:273527 13/56 (23%)

Return to query results.
Submit another query.