DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59f and GSTZ2

DIOPT Version :10

Sequence 1:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_178343.1 Gene:GSTZ2 / 814769 AraportID:AT2G02380 Length:223 Species:Arabidopsis thaliana


Alignment Length:121 Identity:21/121 - (17%)
Similarity:40/121 - (33%) Gaps:52/121 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 QRVSLDRYL----NAIESAIYVVHIFSIMLLTWQCRNWAPKLMTNIVTSDLNRAYTIDCNRTKRF 152
            |.::|.|||    ||.|...::                     ||.:              ||.|
plant   118 QNMALFRYLEDKINAEEKTAWI---------------------TNAI--------------TKGF 147

  Fly   153 IRLQLFLVGIFACLAIFFNIWTHKFVVYRSILSINSYVMPNIISSISFAQYYLLLQ 208
            ..|:..||   :|..        |:.....:...:.::.|.|  ..:|.::::.::
plant   148 TALEKLLV---SCAG--------KYATGDEVYLADLFLAPQI--HAAFNRFHINME 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59fNP_788432.1 7tm_7 61..388 CDD:473258 21/121 (17%)
GSTZ2NP_178343.1 maiA 13..220 CDD:273527 21/121 (17%)

Return to query results.
Submit another query.